Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli Electron transport complex protein RnfE (rnfE)

This Recombinant Escherichia coli Electron transport complex protein RnfE (rnfE) spans the amino acid sequence from region 1-231.

Product Specifications

Product Name Alternative

Electron transport complex protein RnfE

UniProt

Q1RBG4

Expression Region

1-231

Origin

Escherichia coli (strain UTI89 / UPEC)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSEIKDVIVQGLWKNNSALVQLLGLCPLLAVTSTATNALGLGLATTLVLTLTNLTISTLR HWTPAEIRIPIYVMIIASVVSAVQMLINAYAFGLYQSLGIFIPLIVTNCIVVGRAEAFAA KKGPALSALDGFSIGMGATCAMFVLGSLREIIGNGTLFDGADALLGSWAKVLRVEIFRTD SPFLLAMLPPGAFIGLGLMLAGKYLIDEKMKKRRTEAVAERALPNGETGNV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ivosidenib
TRC-I940940-25MG 25 mg

Ivosidenib

Sign In for Pricing
View Details
Moisture Analyzer BANA-510
BANA-510 1 Unit

Moisture Analyzer BANA-510

Sign In for Pricing
View Details
Hieff Trans™ Universal Transfection Reagent
40808ES08 5x 1 mL

Hieff Trans™ Universal Transfection Reagent

Sign In for Pricing
View Details
Kappa Light Chain (TB28-2), CF647 conjugate, 0.1mg/mL
BNC470708-100 1x 100 µL

Kappa Light Chain (TB28-2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Bves Mouse Gene Knockout Kit (CRISPR)
KN502326 1 Kit

Bves Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Human Prostatic Acid Phosphatase/ACPP protein (His tag)
PDEH100943-01 20 µg

Recombinant Human Prostatic Acid Phosphatase/ACPP protein (His tag)

Sign In for Pricing
View Details