Recombinant Mesocricetus auratus Androgen-dependent TFPI-regulating protein (ADTRP)
This Recombinant Mesocricetus auratus Androgen-dependent TFPI-regulating protein (ADTRP) spans the amino acid sequence from region 1-231.
Product Specifications
Product Name Alternative
Androgen-dependent TFPI-regulating protein, Androgen-dependent-expressed protein FAR-17a
UniProt
Q60534
Expression Region
1-231
Origin
Mesocricetus auratus (Golden hamster)
Field of Research
Metabolism Research; Cell Biology
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MTRTTTCVYHFLVWNWYIFLNYYIPLIGKDDEKLKEFHDGGRSKYLTLLNLLLQAIFFGV ACLDDVLKRIIGRKDIKFITSTRDLLFSTLVFPISTFIFLVFWTLFYYDRSLIYPKGLDD YFPAWLNHAMHTYILLFVLVETILRPHHYPSKKLGLALLGACNLAYITRVLWRYSQTGNW VYPVFASLNPLGIIIFFLVCYILNASIYLVGEKINHWKWGATVKPLMKKKK
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC940204-500 1x 500 µL
Complement C4d (C4D204), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC402340-500 1x 500 µL
Tyrosinase-Related Protein-1 (TYRP-1) (Melanoma Marker) (TYRP1/2340R), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940198-500 1x 500 µL
Cytokeratin 18 (DA7), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC610877-500 1x 500 µL
CD99 (MIC2/877), CF660R conjugate, 0.1mg/mL
Sign In for Pricing
View Details