Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Shewanella sp. Electron transport complex protein RnfE (rnfE)

This Recombinant Shewanella sp. Electron transport complex protein RnfE (rnfE) spans the amino acid sequence from region 1-232.

Product Specifications

Product Name Alternative

Electron transport complex protein RnfE

UniProt

A0KX84

Expression Region

1-232

Origin

Shewanella sp. (strain ANA-3)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTNYREIAWQGLWKNNPGLVQLLGLCPLLAVTATLTNALGLGVATMLVLIGSNILVSLVR DYVPKEIRIPVFVMIIAALVTAVQLLINAYAYGLYLSLGIFLPLIVTNCIIIGRAEAFAS RNNAFSAAFDGLMMGLGFTLVLAVLGATREILGQGTLFDGADQLLGPWAKALTIQVWQVD TPFLLAMLPPGAFIVMGLLIALKNVIDKKLKERQPEVAVQPSVTRARITKVS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human KLHL38 activation kit by CRISPRa
GA117474 1 Kit

Human KLHL38 activation kit by CRISPRa

Sign In for Pricing
View Details
Recombinant Mouse NOV/CCN3 Protein (His Tag)
PDMM100169-01 20 µg

Recombinant Mouse NOV/CCN3 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Mouse NOV/CCN3 Protein (His Tag)
PDMM100169-02 100 µg

Recombinant Mouse NOV/CCN3 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Mouse NOV/CCN3 Protein (His Tag)
PDMM100169-03 500 µg

Recombinant Mouse NOV/CCN3 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Mouse NOV/CCN3 Protein (His Tag)
PDMM100169-04 1 mg

Recombinant Mouse NOV/CCN3 Protein (His Tag)

Sign In for Pricing
View Details
OR2H1 Human Recombinant Protein, Synthetic Nanodisc
TP721397M 100 µg

OR2H1 Human Recombinant Protein, Synthetic Nanodisc

Sign In for Pricing
View Details