Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Shewanella sp. Electron transport complex protein RnfE (rnfE)

This Recombinant Shewanella sp. Electron transport complex protein RnfE (rnfE) spans the amino acid sequence from region 1-232.

Product Specifications

Product Name Alternative

Electron transport complex protein RnfE

UniProt

A1RJZ7

Expression Region

1-232

Origin

Shewanella sp. (strain W3-18-1)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTNYREIAWQGLWKNNPGLVQLLGLCPLLAVTATITNALGLGVATMLVLIGSNILVSLVR DYVPKEIRIPVFVMIIAALVTTVQLLINAYAYGLYLSLGIFLPLIVTNCIIIGRAEAFAS RNNAFSAAFDGLMMGLGFTLVLAVLGATRELLGQGTLFDGADQLLGPWAKSLTIHVWQVD TPFLLAMLPPGAFIVMGLLIALKNVIDKKLKEHQPQVATEPSVTRARITKVS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Kidney
CS803128 5x 5 µm

Tissue FFPE Sections, Kidney

Sign In for Pricing
View Details
Slc2a6 Mouse Gene Knockout Kit (CRISPR)
KN516033 1 Kit

Slc2a6 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ARFGAP1 Rabbit Polyclonal Antibody
TA364606 100 µL

ARFGAP1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Trpv2 activation kit by CRISPRa
GA204612 1 Kit

Mouse Trpv2 activation kit by CRISPRa

Sign In for Pricing
View Details
Tryptamine
TRC-T894600-50G 50 g

Tryptamine

Sign In for Pricing
View Details
MK 0773
TRC-M424980-1MG 1 mg

MK 0773

Sign In for Pricing
View Details