Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Shewanella putrefaciens Electron transport complex protein RnfE (rnfE)

This Recombinant Shewanella putrefaciens Electron transport complex protein RnfE (rnfE) spans the amino acid sequence from region 1-232.

Product Specifications

Product Name Alternative

Electron transport complex protein RnfE

UniProt

A4Y6I5

Expression Region

1-232

Origin

Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTNYREIAWQGLWKNNPGLVQLLGLCPLLAVTATITNALGLGVATMLVLIGSNILVSLVR DYVPKEIRIPVFVMIIAALVTTVQLLINAYAYGLYLSLGIFLPLIVTNCIIIGRAEAFAS RNNAFSAAFDGLMMGLGFTLVLAVLGATRELLGQGTLFDGADQLLGPWAKSLTIHVWQVD TPFLLAMLPPGAFIVMGLLIALKNVIDKKLKEHQPQVATEPSVTRARITKVS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PCNA Human Knockdown Lysate
LY300265 100 µg

PCNA Human Knockdown Lysate

Sign In for Pricing
View Details
Cnnm3 Mouse Gene Knockout Kit (CRISPR)
KN503555 1 Kit

Cnnm3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
STEA2 Antibody
8C11375-AAT 50 µg

STEA2 Antibody

Sign In for Pricing
View Details
Rat FE (Ferritin) ELISA Kit
E-EL-R3018-01 24 Tests

Rat FE (Ferritin) ELISA Kit

Sign In for Pricing
View Details
Rat FE (Ferritin) ELISA Kit
E-EL-R3018-02 48 Tests

Rat FE (Ferritin) ELISA Kit

Sign In for Pricing
View Details
Rat FE (Ferritin) ELISA Kit
E-EL-R3018-03 96 Tests

Rat FE (Ferritin) ELISA Kit

Sign In for Pricing
View Details