Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Shewanella putrefaciens Electron transport complex protein RnfE (rnfE)

This Recombinant Shewanella putrefaciens Electron transport complex protein RnfE (rnfE) spans the amino acid sequence from region 1-232.

Product Specifications

Product Name Alternative

Electron transport complex protein RnfE

UniProt

A4Y6I5

Expression Region

1-232

Origin

Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTNYREIAWQGLWKNNPGLVQLLGLCPLLAVTATITNALGLGVATMLVLIGSNILVSLVR DYVPKEIRIPVFVMIIAALVTTVQLLINAYAYGLYLSLGIFLPLIVTNCIIIGRAEAFAS RNNAFSAAFDGLMMGLGFTLVLAVLGATRELLGQGTLFDGADQLLGPWAKSLTIHVWQVD TPFLLAMLPPGAFIVMGLLIALKNVIDKKLKEHQPQVATEPSVTRARITKVS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TLR5 Human Recombinant Protein, Membrane Nanoparticle
TP721875M 100 µg

TLR5 Human Recombinant Protein, Membrane Nanoparticle

Sign In for Pricing
View Details
POLR3H (NM_001018050) Human Over-expression Lysate
LY422705 100 µg

POLR3H (NM_001018050) Human Over-expression Lysate

Sign In for Pricing
View Details
CD28 (C28/76), CF488A conjugate, 0.1mg/mL
BNC880076-500 1x 500 µL

CD28 (C28/76), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
O4-Desacetyl Vinblastinic Acid
TRC-D281895-1MG 1 mg

O4-Desacetyl Vinblastinic Acid

Sign In for Pricing
View Details
Recombinant Glutaminase Antibody
RC-4963-01 50 μL

Recombinant Glutaminase Antibody

Sign In for Pricing
View Details
Recombinant Glutaminase Antibody
RC-4963-02 100 µL

Recombinant Glutaminase Antibody

Sign In for Pricing
View Details