Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Shewanella baltica Electron transport complex protein RnfE (rnfE)

This Recombinant Shewanella baltica Electron transport complex protein RnfE (rnfE) spans the amino acid sequence from region 1-232.

Product Specifications

Product Name Alternative

Electron transport complex protein RnfE

UniProt

A6WN13

Expression Region

1-232

Origin

Shewanella baltica (strain OS185)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTNYREIAWQGLWKNNPGLVQLLGLCPLLAVTATITNALGLGLATMLVLIGSNILVSLVR DYVPKEIRIPVFVMIIAALVTTVQLLINAYAYGLYLSLGIFLPLIVTNCIIIGRAEAFAS RNNAFSAAFDGLMMGLGFTLVLTVLGATREILGQGTLFDGADQLLGPWAKSLTIHLWQVD TPFLLAMLPPGAFIVMGLLIALKNVIDKKVKERQPQVAAEPSVTRARITKVG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Hu CD48 APC
1A-226-T025 25 Tests

Anti-Hu CD48 APC

Sign In for Pricing
View Details
SV40 T-Ag-derived NLS peptide
MBS5789363 Inquire

SV40 T-Ag-derived NLS peptide

Sign In for Pricing
View Details
PCDHGB5 Antibody
46638 100 µL

PCDHGB5 Antibody

Sign In for Pricing
View Details
Rusalatide acetate (497221-38-2 free base)
orb1296787-01 2 mg

Rusalatide acetate (497221-38-2 free base)

Sign In for Pricing
View Details
Rusalatide acetate (497221-38-2 free base)
orb1296787-02 5 mg

Rusalatide acetate (497221-38-2 free base)

Sign In for Pricing
View Details
Rusalatide acetate (497221-38-2 free base)
orb1296787-03 10 mg

Rusalatide acetate (497221-38-2 free base)

Sign In for Pricing
View Details