Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Sodalis glossinidius Electron transport complex protein RnfE (rnfE)

This Recombinant Sodalis glossinidius Electron transport complex protein RnfE (rnfE) spans the amino acid sequence from region 1-232.

Product Specifications

Product Name Alternative

Electron transport complex protein RnfE

UniProt

Q2NT00

Expression Region

1-232

Origin

Sodalis glossinidius (strain morsitans)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNEAKRILLEGLWRNNSSLVQLLGLCPLLAVSNTATNALGLGLATTLVLVCTNTAVSALR RWITGEIRIPIYVMIIASVVSAVQMLINAYAFGLYQSLGIFIPLIVTNCIVIGRAEAYAS QRPPALAALDGLSIGLGSTCTLLLLGALREVLGNGTLFDGADQLLGAWARVLRIEVFHTD TPFLLAMLPPGAFIGLGFMLVGKYLIDQRMKARQPKAARPVVLQQGQPLADE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

WISP1 rabbit pAb
ES10916-01 50 µL

WISP1 rabbit pAb

Sign In for Pricing
View Details
WISP1 rabbit pAb
ES10916-02 100 µL

WISP1 rabbit pAb

Sign In for Pricing
View Details
Cat IgG (H&L) Antibody F (ab') 2 - AP Conjugated
OARA03846-500UG 500 µg

Cat IgG (H&L) Antibody F (ab') 2 - AP Conjugated

Sign In for Pricing
View Details
NOS-3 Antibody
250785 0.1 mg

NOS-3 Antibody

Sign In for Pricing
View Details
Mouse Mrgbp Pre-designed siRNA Set A
SI108662A 1 Each

Mouse Mrgbp Pre-designed siRNA Set A

Sign In for Pricing
View Details
RAD1 (Cell Cycle Checkpoint Protein RAD1, hRAD1, DNA Repair Exonuclease Rad1 Homolog, Rad1-like DNA Damage Checkpoint Protein, REC1) (Biotin)
MBS6143896-01 0.1 mL

RAD1 (Cell Cycle Checkpoint Protein RAD1, hRAD1, DNA Repair Exonuclease Rad1 Homolog, Rad1-like DNA Damage Checkpoint Protein, REC1) (Biotin)

Sign In for Pricing
View Details