Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Sodalis glossinidius Electron transport complex protein RnfE (rnfE)

This Recombinant Sodalis glossinidius Electron transport complex protein RnfE (rnfE) spans the amino acid sequence from region 1-232.

Product Specifications

Product Name Alternative

Electron transport complex protein RnfE

UniProt

Q2NT00

Expression Region

1-232

Origin

Sodalis glossinidius (strain morsitans)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNEAKRILLEGLWRNNSSLVQLLGLCPLLAVSNTATNALGLGLATTLVLVCTNTAVSALR RWITGEIRIPIYVMIIASVVSAVQMLINAYAFGLYQSLGIFIPLIVTNCIVIGRAEAYAS QRPPALAALDGLSIGLGSTCTLLLLGALREVLGNGTLFDGADQLLGAWARVLRIEVFHTD TPFLLAMLPPGAFIGLGFMLVGKYLIDQRMKARQPKAARPVVLQQGQPLADE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Neonatal Epidermal Keratinocytes (NEK)
abx700132 5x 10^5 Cells

Rat Neonatal Epidermal Keratinocytes (NEK)

Sign In for Pricing
View Details
Colipase Antibody / CLPS
V5667-20UG 20 µg

Colipase Antibody / CLPS

Sign In for Pricing
View Details
ATP5J2 Rabbit pAb (APR23499N)
APR23499N-01 50 µL

ATP5J2 Rabbit pAb (APR23499N)

Sign In for Pricing
View Details
ATP5J2 Rabbit pAb (APR23499N)
APR23499N-02 100 µL

ATP5J2 Rabbit pAb (APR23499N)

Sign In for Pricing
View Details
ATP5J2 Rabbit pAb (APR23499N)
APR23499N-03 200 µL

ATP5J2 Rabbit pAb (APR23499N)

Sign In for Pricing
View Details
NAALAD2 Protein Lysate (Mouse) with C-HA Tag
31378034 100 µg

NAALAD2 Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details