Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Aquaporin Z (aqpZ)

This Recombinant Aquaporin Z (aqpZ) spans the amino acid sequence from region 1-232.

Product Specifications

Product Name Alternative

Aquaporin Z

UniProt

Q87MQ5

Expression Region

1-232

Origin

Vibrio parahaemolyticus

Field of Research

Kidney & Urological Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNKYLAEAFGTFWLVLGGCGSAVLAAGFPDVGIGLLGVALAFGLTVLTMAFAIGHISGCH LNPAVTVGLWAGGRFDTKDVAPYIIAQVIGGLIAGGILYVIATGQAGFDVVGSGFAANGY GEHSPGQYSMLAALVSEIVMTMMFLIVIMGATDKRAPQGFAPIAIGLCLTLIHLISIPVT NTSVNPARSTAVAMYVGDWAVSQLWLFWVAPIVGGVLGAVIYKNLLGKESND

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACTH (Adrenocorticotrophic Hormone) (AH26), CF488A conjugate, 0.1mg/mL
BNC880026-100 1x 100 µL

ACTH (Adrenocorticotrophic Hormone) (AH26), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD81 / TAPA-1 (1.3.3.22), CF594 conjugate, 0.1mg/mL
BNC940391-100 1x 100 µL

CD81 / TAPA-1 (1.3.3.22), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP27 (G3.1), CF594 conjugate, 0.1mg/mL
BNC940861-500 1x 500 µL

HSP27 (G3.1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (156-3C11), CF594 conjugate, 0.1mg/mL
BNC940460-100 1x 100 µL

CD44 Standard (156-3C11), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (AH26), CF594 conjugate, 0.1mg/mL
BNC940026-100 1x 100 µL

ACTH (Adrenocorticotrophic Hormone) (AH26), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fascin-1 (FSCN1/417), CF640R conjugate, 0.1mg/mL
BNC400417-500 1x 500 µL

Fascin-1 (FSCN1/417), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details