Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Yersinia pseudotuberculosis serotype O:3 Electron transport complex protein RnfE (rnfE)

This Recombinant Yersinia pseudotuberculosis serotype O:3 Electron transport complex protein RnfE (rnfE) spans the amino acid sequence from region 1-233.

Product Specifications

Product Name Alternative

Electron transport complex protein RnfE

UniProt

B1JKN8

Expression Region

1-233

Origin

Yersinia pseudotuberculosis serotype O:3 (strain YPIII)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSEAKKLLAQGLWKNNSALVQLLGLCPLLAVSSTATNALGLGLATTLVLVCTNTAVSALR RWVPSEIRIPIYVMIIASVVSTVQMLINAYAFGLYQSLGIFIPLIVTNCIVIGRAEAYAA KNPVGLSALDGFAMGMGATCALFVLGALREILGNGTLFDGADMLLGSWATVLRIDILHLD TPFLLAMLPPGAFIGLGLLLAGKYVIDEKMKARKANTRVSVPQLQDGDAEKAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SOX9 / SRY-box 9 (SOX9/2287R), CF594 conjugate, 0.1mg/mL
BNC942287-100 1x 100 µL

SOX9 / SRY-box 9 (SOX9/2287R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
2-Cyclohexyl-4,6-dinitrophenol
TRC-C990029-1G 1 g

2-Cyclohexyl-4,6-dinitrophenol

Sign In for Pricing
View Details
ZFYVE28 (Zinc Finger FYVE-type containing 28) (LST2/2426), CF640R conjugate, 0.1mg/mL
BNC402426-500 1x 500 µL

ZFYVE28 (Zinc Finger FYVE-type containing 28) (LST2/2426), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Chromogranin A (LK2H10 + PHE5), CF568 conjugate, 0.1mg/mL
BNC680698-100 1x 100 µL

Chromogranin A (LK2H10 + PHE5), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ADM5 (NM_001101340) Human Over-expression Lysate
LY426140 100 µg

ADM5 (NM_001101340) Human Over-expression Lysate

Sign In for Pricing
View Details
Stayright™ Purple HRP Staining Kit
45905-AAT 5 mL

Stayright™ Purple HRP Staining Kit

Sign In for Pricing
View Details