Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ1036 (MJ1036)

This Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ1036 (MJ1036) spans the amino acid sequence from region 1-233.

Product Specifications

Product Name Alternative

Uncharacterized protein MJ1036

UniProt

Q58442

Expression Region

1-233

Origin

Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSNMVEVPIFIAILSFIVMCIGELLAYYSVSLKYKYEFEAISFGFIFGVATLILIPKSYS NMFVLYVILGMITVYLIEKYLAYCPLSKKYCVECDNLEENRIKFIYPISFFIHTFIDGLI IAVSYISEIGLPLYLAILMHKLPAGFVLISPLKGVYKNPLYPGVFVSFGTVLGTIVGLVT LKDVSTKILLAFSGGVFLGAFLMLAPHIYEHKEEKTFLYILLGYILVGIIALH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ethyl 2,2-difluoro-5-azaspiro[2.3]hexane-1-carboxylate hydrochloride
PC512041 1 Each

Ethyl 2,2-difluoro-5-azaspiro[2.3]hexane-1-carboxylate hydrochloride

Sign In for Pricing
View Details
CD178 Antibody
E38PA1068 100 µL

CD178 Antibody

Sign In for Pricing
View Details
Goat Hemojuvelin ELISA Kit
MBS023079 Inquire

Goat Hemojuvelin ELISA Kit

Sign In for Pricing
View Details
Human ZNF559 Pre-designed siRNA Set B
SI018899B 1 Each

Human ZNF559 Pre-designed siRNA Set B

Sign In for Pricing
View Details
IRF5 (NM_001098630) Human Tagged ORF Clone Lentiviral Particle
RC215781L2V 200 µL

IRF5 (NM_001098630) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
ASPH (Aspartyl/Asparaginyl beta-hydroxylase, Aspartate beta-hydroxylase, ASP beta-hydroxylase, Peptide-aspartate beta-dioxygenase) (AP)
MBS6370551-01 0.1 mL

ASPH (Aspartyl/Asparaginyl beta-hydroxylase, Aspartate beta-hydroxylase, ASP beta-hydroxylase, Peptide-aspartate beta-dioxygenase) (AP)

Sign In for Pricing
View Details