Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pelobacter carbinolicus ATP synthase subunit a 2 (atpB2)

This Recombinant Pelobacter carbinolicus ATP synthase subunit a 2 (atpB2) spans the amino acid sequence from region 1-234.

Product Specifications

Product Name Alternative

ATP synthase subunit a 2, ATP synthase F0 sector subunit a 2, F-ATPase subunit 6 2

UniProt

Q3A603

Expression Region

1-234

Origin

Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTHPFVLLKWLIAKLHFGFSAEMLEQHGFFQHVTHTWLVMAILIGVGLLATHRAGLVPGG MQNFMELVLVEIRGMVRDTMGPKGMVYFPLIATLALFLLVSNLIGLIPGFAPPTASLNTN AALAVGVFLVTHIVGVREHGIRYFKHFMGPVWWLTPLILPIELIGHLARPLSLSLRLFGN MYGHEIVLMIFFSLVPLLLPIPMMLMGILVAFIQTFVFMLLSMIYIAGALEEAH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Spectrin beta III (SPTBN2) (SPTBN2/2979R), 0.2mg/mL
BNUB2979-100 1x 100 µL

Spectrin beta III (SPTBN2) (SPTBN2/2979R), 0.2mg/mL

Sign In for Pricing
View Details
Human MOCS3 activation kit by CRISPRa
GA109113 1 Kit

Human MOCS3 activation kit by CRISPRa

Sign In for Pricing
View Details
Rhodopsin (RHO) (NM_000539) Human Over-expression Lysate
LC400184 20 µg

Rhodopsin (RHO) (NM_000539) Human Over-expression Lysate

Sign In for Pricing
View Details
LNK (SH2B3) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2D8]
TA502764AM 100 µL

LNK (SH2B3) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2D8]

Sign In for Pricing
View Details
Rabbit Anti-Avidin Colloidal Gold, 1mL 10nm
GAA-02-10 1 mL

Rabbit Anti-Avidin Colloidal Gold, 1mL 10nm

Sign In for Pricing
View Details
STUB1 Rabbit Polyclonal Antibody
TA382159 100 µL

STUB1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details