Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pelobacter carbinolicus ATP synthase subunit a 2 (atpB2)

This Recombinant Pelobacter carbinolicus ATP synthase subunit a 2 (atpB2) spans the amino acid sequence from region 1-234.

Product Specifications

Product Name Alternative

ATP synthase subunit a 2, ATP synthase F0 sector subunit a 2, F-ATPase subunit 6 2

UniProt

Q3A603

Expression Region

1-234

Origin

Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTHPFVLLKWLIAKLHFGFSAEMLEQHGFFQHVTHTWLVMAILIGVGLLATHRAGLVPGG MQNFMELVLVEIRGMVRDTMGPKGMVYFPLIATLALFLLVSNLIGLIPGFAPPTASLNTN AALAVGVFLVTHIVGVREHGIRYFKHFMGPVWWLTPLILPIELIGHLARPLSLSLRLFGN MYGHEIVLMIFFSLVPLLLPIPMMLMGILVAFIQTFVFMLLSMIYIAGALEEAH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Liver
CS806036 5x 5 µm

Tissue FFPE Sections, Liver

Sign In for Pricing
View Details
Tissue FFPE Sections, Colon
CS702237 5x 5 µm

Tissue FFPE Sections, Colon

Sign In for Pricing
View Details
EverBrite TrueBlack® Hardset Mounting Medium
#23017-T 1x 2 mL

EverBrite TrueBlack® Hardset Mounting Medium

Sign In for Pricing
View Details
Recombinant TUB1 Antibody
RC-16495-01 50 μL

Recombinant TUB1 Antibody

Sign In for Pricing
View Details
Recombinant TUB1 Antibody
RC-16495-02 100 µL

Recombinant TUB1 Antibody

Sign In for Pricing
View Details
Recombinant TUB1 Antibody
RC-16495-03 1 mL

Recombinant TUB1 Antibody

Sign In for Pricing
View Details