Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Putative gustatory receptor clone PTE38

This Recombinant Rat Putative gustatory receptor clone PTE38 spans the amino acid sequence from region 1-234.

Product Specifications

Product Name Alternative

Putative gustatory receptor clone PTE38

UniProt

P35897

Expression Region

1-234

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MYLFFSNLSFNDICIITTTIPKMLMNVQSHDQSITYLGCLSQVYLIVNFGSIESCLLAVM AYDRYVAICHPLKYTVIMNHYFCVMLLLFACSLALHMCLFHILMVLILTFCTKTEIPHFF CELAHIIKLTCSDNFINYLLIYTVSVLFFGVHIVGIILSYIYTVSSVLRMSLLGGMYKAF STCGSHLSVVSLFYGTGFGVHISSPLTDSPRKTVVASVMYTVVTQMHGPFIYSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZBTB20 Rabbit Polyclonal Antibody
TA369497 100 µL

ZBTB20 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
2’-Deoxy-5-hydroxyuridine
TRC-D281525-2.5MG 2.5 mg

2’-Deoxy-5-hydroxyuridine

Sign In for Pricing
View Details
Tissue Genomic DNA, Breast
CD564442 5 µg

Tissue Genomic DNA, Breast

Sign In for Pricing
View Details
Glutamyl Prolyl tRNA synthetase (EPRS) (N-term) Rabbit Polyclonal Antibody
AP14211PU-N 400 µL

Glutamyl Prolyl tRNA synthetase (EPRS) (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Dechlorane 604 Component A
TRC-D226210-50MG 50 mg

Dechlorane 604 Component A

Sign In for Pricing
View Details
Fascin (FSCN1) Rabbit Polyclonal Antibody
AP17358PU-N 400 µL

Fascin (FSCN1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details