Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Zea mays Ascorbate-specific transmembrane electron transporter 2

This Recombinant Zea mays Ascorbate-specific transmembrane electron transporter 2 spans the amino acid sequence from region 1-236.

Product Specifications

Product Name Alternative

Ascorbate-specific transmembrane electron transporter 2, EC= 1.-.-.-, Cytochrome b561-2

UniProt

C4IYS8

Expression Region

1-236

Origin

Zea mays (Maize)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGLGLGVRAAPFTYAAHALAVAAAAMVLVWAIYFRGGLAIEATNKNLIFNVHPVLMLIGY IIIGGEAIMVYRVLPTSNHETNKLIHLVLHGIALVLGAVGIYFAFKNHNESGIANLYSLH SWIGIGTITLYGIQWIVGFVTFFFPGAAPNVKKGVLPWHILFGLFVYILALANAELGFLE KLTFLESSGLDKYGTEAFLVNFTALVVVLFGASVVVAAIAPVRLEEPQGYVPIPEN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ABHD4 siRNA (Mouse)
CRN0721-01 15 nmol

ABHD4 siRNA (Mouse)

Sign In for Pricing
View Details
ABHD4 siRNA (Mouse)
CRN0721-02 30 nmol

ABHD4 siRNA (Mouse)

Sign In for Pricing
View Details
Human PON1 Protein
orb753052-01 2 µg

Human PON1 Protein

Sign In for Pricing
View Details
Human PON1 Protein
orb753052-02 10 µg

Human PON1 Protein

Sign In for Pricing
View Details
Human PON1 Protein
orb753052-03 1 mg

Human PON1 Protein

Sign In for Pricing
View Details
FolE Antibody
orb816433 2 mg

FolE Antibody

Sign In for Pricing
View Details