Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Lactococcus lactis subsp. lactis UPF0177 protein yaiH (yaiH)

This Recombinant Lactococcus lactis subsp. lactis UPF0177 protein yaiH (yaiH) spans the amino acid sequence from region 1-236.

Product Specifications

Product Name Alternative

UPF0177 protein yaiH

UniProt

Q9CJB2

Expression Region

1-236

Origin

Lactococcus lactis subsp. lactis (strain IL1403) (Streptococcus lactis)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMDDSFKNYWMNKLKYFSLFILLFAIYWFPDVILGYPEIYLKSLVGYDRQATATWIFLGN MAISLFLGILICYKLGYYKNTLSIFKIKNILFLLFTTIVLFIIYFFTFTYYNSHFITPGI AKEQAAYSRQIVFPFVQFISFAICAPIFEEAAFRTTIYRFFKNDKIAFIVSSISFAWMHT GANPILIVYLPMSVVLTLIYHRRRVLGESILVHCLMNALLPTIIVFLQTITGLYYL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD86 (BU63), CF405S conjugate, 0.1mg/mL
BNC040193-500 1x 500 µL

CD86 (BU63), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 (ICAM-3) (101-1D2), CF488A conjugate, 0.1mg/mL
BNC880177-100 1x 100 µL

CD50 (ICAM-3) (101-1D2), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P27 / KIP1 (SX53G8), CF594 conjugate, 0.1mg/mL
BNC940669-100 1x 100 µL

P27 / KIP1 (SX53G8), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TAG-72 / CA72.4 (B72.3), CF405S conjugate, 0.1mg/mL
BNC040276-100 1x 100 µL

TAG-72 / CA72.4 (B72.3), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SOX9 / SRY-box 9 (SOX9/2398), CF488A conjugate, 0.1mg/mL
BNC882398-500 1x 500 µL

SOX9 / SRY-box 9 (SOX9/2398), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human Lambda Light Chain (LcN-2), CF405S conjugate, 0.1mg/mL
BNC040631-100 1x 100 µL

Human Lambda Light Chain (LcN-2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details