Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Marinobacter aquaeolei Electron transport complex protein RnfE (rnfE)

This Recombinant Marinobacter aquaeolei Electron transport complex protein RnfE (rnfE) spans the amino acid sequence from region 1-238.

Product Specifications

Product Name Alternative

Electron transport complex protein RnfE, Nitrogen fixation protein RnfE

UniProt

A1TZ60

Expression Region

1-238

Origin

Marinobacter aquaeolei (strain ATCC 700491 / DSM 11845 / VT8) (Marinobacter hydrocarbonoclasticus (strain DSM 11845) )

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSTKTSSEIIKDGLWHNNPALVQVLGLCPLLAVTSTVVNAIGLGLATLLVLMGSNLSVSL IRNFVSESVRLPAFVMIIASFVTCAELLMQAFTYELYQILGIFIPLIVTNCAILGRADAF ASKNPPLPAILDGAMMGIGFLAVLMTLGAMRELIGQGTLFADMHLLLGPMAADWVIRPLE QYPDMLFMVLPPGAFVGLGLLIALKNGIDNHLKERRKAAEPAPASTGSKRVRVTGTIS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

QL-X-138 HCl
BUP00770-01 1 mg

QL-X-138 HCl

Sign In for Pricing
View Details
QL-X-138 HCl
BUP00770-02 5 mg

QL-X-138 HCl

Sign In for Pricing
View Details
QL-X-138 HCl
BUP00770-03 10 mg

QL-X-138 HCl

Sign In for Pricing
View Details
QL-X-138 HCl
BUP00770-04 25 mg

QL-X-138 HCl

Sign In for Pricing
View Details
QL-X-138 HCl
BUP00770-05 50 mg

QL-X-138 HCl

Sign In for Pricing
View Details
Human Fatty acid-binding protein, brain, FABP7/BLBP/FABPB/MRG ELISA Kit
MBS1606193-01 48 Well

Human Fatty acid-binding protein, brain, FABP7/BLBP/FABPB/MRG ELISA Kit

Sign In for Pricing
View Details