Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0902 (MJ0902)

This Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0902 (MJ0902) spans the amino acid sequence from region 1-238.

Product Specifications

Product Name Alternative

Uncharacterized protein MJ0902

UniProt

Q58312

Expression Region

1-238

Origin

Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGEKMINFIVGAIGLLIASIYDLKSREIEDYVWVSMVIFGLIYNGYLSFISHDMLYVIQS IVGFIVCFFLGFFMFLLGVGGGDGKLIMGLGALIPKYNMPIHTPLGAILNYLYLPSFPIM VVINAMFFSITLPIIIFLRNVIRGVKPKTKKEVLCMFLGEKMKVSEAIKKERLILGNHEN LKLLPSAEKDCDFSKFDKNEEIWVTPAIPFVVPIFLSYLLTSIIGDKIIGIFLSVFGL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(R)-Pantoic Acid Sodium Salt
TRC-P181505-1G 1 g

(R)-Pantoic Acid Sodium Salt

Sign In for Pricing
View Details
Parathyroid Hormone (PTH) (N-Terminal) (PTH/2295R), Biotin conjugate, 0.1mg/mL
BNCB2295-100 1x 100 µL

Parathyroid Hormone (PTH) (N-Terminal) (PTH/2295R), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant HMCES Antibody
RN-14596-01 50 μL

Recombinant HMCES Antibody

Sign In for Pricing
View Details
Recombinant HMCES Antibody
RN-14596-02 100 µL

Recombinant HMCES Antibody

Sign In for Pricing
View Details
Recombinant HMCES Antibody
RN-14596-03 1 mL

Recombinant HMCES Antibody

Sign In for Pricing
View Details
5- (and-6-) - ((N- (5-aminopentyl) amino) carbonyl) Tetramethylrhodamine (Tetramethylrhodamine cadaverine) (mixed isomer)
#92001 1x 10 mg

5- (and-6-) - ((N- (5-aminopentyl) amino) carbonyl) Tetramethylrhodamine (Tetramethylrhodamine cadaverine) (mixed isomer)

Sign In for Pricing
View Details