Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0902 (MJ0902)

This Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0902 (MJ0902) spans the amino acid sequence from region 1-238.

Product Specifications

Product Name Alternative

Uncharacterized protein MJ0902

UniProt

Q58312

Expression Region

1-238

Origin

Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGEKMINFIVGAIGLLIASIYDLKSREIEDYVWVSMVIFGLIYNGYLSFISHDMLYVIQS IVGFIVCFFLGFFMFLLGVGGGDGKLIMGLGALIPKYNMPIHTPLGAILNYLYLPSFPIM VVINAMFFSITLPIIIFLRNVIRGVKPKTKKEVLCMFLGEKMKVSEAIKKERLILGNHEN LKLLPSAEKDCDFSKFDKNEEIWVTPAIPFVVPIFLSYLLTSIIGDKIIGIFLSVFGL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FAK (PTK2) Rabbit Polyclonal Antibody
AP20688PU-N 100 µg

FAK (PTK2) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Best3 Mouse Gene Knockout Kit (CRISPR)
KN502140 1 Kit

Best3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Ferritin, Light Chain (FTL) (Microglia Marker) (FTL/1387), CF488A conjugate, 0.1mg/mL
BNC881387-500 1x 500 µL

Ferritin, Light Chain (FTL) (Microglia Marker) (FTL/1387), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
(+/-)-Lisofylline
TRC-L469050-25MG 25 mg

(+/-)-Lisofylline

Sign In for Pricing
View Details
Zfp454 Mouse Gene Knockout Kit (CRISPR)
KN519843 1 Kit

Zfp454 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
BLAP75 (RMI1) (NM_024945) Human Recombinant Protein
TP308030M 100 µg

BLAP75 (RMI1) (NM_024945) Human Recombinant Protein

Sign In for Pricing
View Details