Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Protein lifeguard 4 (Tmbim4)

This Recombinant Mouse Protein lifeguard 4 (Tmbim4) spans the amino acid sequence from region 1-238.

Product Specifications

Product Name Alternative

Protein lifeguard 4, Transmembrane BAX inhibitor motif-containing protein 4, Z-protein

UniProt

Q9DA39

Expression Region

1-238

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MADTDPGYPRSSIEDDFNYGSCVASASVHIRMAFLRKVYSILSLQVLLTTVTSALFLYFQ ALRTFVHESPALIVVFALGSLGLIFALTLHRHTHPLNLYLLFAFTLSESLAVAAVVTFYD VYLVLQAFIMTTAVFLGLTAYTLQSKRDFTKFGAGLFAGLWILCLAGFLKLFFYSETMEL VLASLGALLFCGFIIYDTHSLMHRLSPEEYVIAAISLYMDIINLFLHLLKFLEAVNKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Artery: peripheral
CS508868 5x 5 µm

Frozen Tissue Sections, Artery: peripheral

Sign In for Pricing
View Details
1,1,2,2,3,3,4,4,4-Nonafluoro-N-(2-hydroxyethyl)-1-butanesulfonamide
TRC-N649505-50MG 50 mg

1,1,2,2,3,3,4,4,4-Nonafluoro-N-(2-hydroxyethyl)-1-butanesulfonamide

Sign In for Pricing
View Details
CTU2 Recombinant Rabbit monoclonal Antibody
HA750928 100 µL

CTU2 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
OGT (NM_181672) Human Recombinant Protein
TP306822 20 µg

OGT (NM_181672) Human Recombinant Protein

Sign In for Pricing
View Details
Podophyllotoxin 4-O-Glucoside
TRC-P681010-1MG 1 mg

Podophyllotoxin 4-O-Glucoside

Sign In for Pricing
View Details
DNTP Mix, 10mM each, 5x1mL
#40054 5x 1 mL

DNTP Mix, 10mM each, 5x1mL

Sign In for Pricing
View Details