Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pediococcus pentosaceus ATP synthase subunit a (atpB)

This Recombinant Pediococcus pentosaceus ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-238.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

Q03EK8

Expression Region

1-238

Origin

Pediococcus pentosaceus (strain ATCC 25745 / 183-1w)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSGESISTFQFLGLTFNTTNLISGLVSALIVFCVVFALSRNLKLKPTGKQNILEWIVDFT NGILRDSVDEEEEKNFGLYAFTLFLFIFVSNQIGLFLQIAWNDVSYLRSPTADPIVTLTL SLITMMLAHYSGVAKFGFKKYFEKTYLSPFKVWLPIGVFTEFIDFLTLGLRIYGVIFAGE MLLKMIGGIAFSGGIVNMIVAIPLALIWQGFSVFLGSIQAFVFVTLTSVYISHKVEDE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DAA (1, 2-Diaminoanthraquinone), 10 mg
#00300 1x 10 mg

DAA (1, 2-Diaminoanthraquinone), 10 mg

Sign In for Pricing
View Details
Jaceosidin
TRC-J125450-10MG 10 mg

Jaceosidin

Sign In for Pricing
View Details
OptiWell™ Deep Well Plates
D3096-33S 50 Units/Case

OptiWell™ Deep Well Plates

Sign In for Pricing
View Details
Large Capacity Water Purification System BCPS-315
BCPS-315 1 Unit

Large Capacity Water Purification System BCPS-315

Sign In for Pricing
View Details
NM23 Recombinant Mouse monoclonal Antibody
HA610070 100 µg

NM23 Recombinant Mouse monoclonal Antibody

Sign In for Pricing
View Details
PARP2 Human Gene Knockout Kit (CRISPR)
KN213586LP 1 Kit

PARP2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details