Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pediococcus pentosaceus ATP synthase subunit a (atpB)

This Recombinant Pediococcus pentosaceus ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-238.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

Q03EK8

Expression Region

1-238

Origin

Pediococcus pentosaceus (strain ATCC 25745 / 183-1w)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSGESISTFQFLGLTFNTTNLISGLVSALIVFCVVFALSRNLKLKPTGKQNILEWIVDFT NGILRDSVDEEEEKNFGLYAFTLFLFIFVSNQIGLFLQIAWNDVSYLRSPTADPIVTLTL SLITMMLAHYSGVAKFGFKKYFEKTYLSPFKVWLPIGVFTEFIDFLTLGLRIYGVIFAGE MLLKMIGGIAFSGGIVNMIVAIPLALIWQGFSVFLGSIQAFVFVTLTSVYISHKVEDE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

APC-iFluor® 750 Tandem
2626-AAT 1 mg

APC-iFluor® 750 Tandem

Sign In for Pricing
View Details
alpha A Crystallin (CRYAA) Human Gene Knockout Kit (CRISPR)
KN216946BN 1 Kit

alpha A Crystallin (CRYAA) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
2-(2-Chloroethoxy)ethylphosphonic Acid
TRC-B406220-50MG 50 mg

2-(2-Chloroethoxy)ethylphosphonic Acid

Sign In for Pricing
View Details
Human OSBPL5 activation kit by CRISPRa
GA114479 1 Kit

Human OSBPL5 activation kit by CRISPRa

Sign In for Pricing
View Details
Pmel17 / gp100 / SILV (PMEL/783), CF594 conjugate, 0.1mg/mL
BNC940783-500 1x 500 µL

Pmel17 / gp100 / SILV (PMEL/783), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MSL1 Human Gene Knockout Kit (CRISPR)
KN421031 1 Kit

MSL1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details