Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Paracoccus denitrificans Heme exporter protein C (ccmC)

This Recombinant Paracoccus denitrificans Heme exporter protein C (ccmC) spans the amino acid sequence from region 1-241.

Product Specifications

Product Name Alternative

Heme exporter protein C, Cytochrome c-type biogenesis protein CcmC

UniProt

P52220

Expression Region

1-241

Origin

Paracoccus denitrificans (strain Pd 1222)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSIWEYANPVKFMRTSGAILPWVVAGAAACTVTGLVWGFLTPEDYKQGATVKIIFLHVPA ALMAINIWLMMLVTSLIWLIRRHHVSALAAKAAAPVGAVMTLIALITGAIWGQPMWGTWW EWDPRLTSFLILFLFYLGYMALWEAVENPDSAADLTGVLCLVGSVFALLSRYAVNFWNQG LHQGASLSMAPGERMAAVYRYPLYLTMAGFFLLFLALLLIRTRTEIRRRRLAALLARENR A

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-Quinoxalinecarboxylic Acid
TRC-Q765265-500MG 500 mg

2-Quinoxalinecarboxylic Acid

Sign In for Pricing
View Details
Cd2 Mouse Gene Knockout Kit (CRISPR)
KN502873 1 Kit

Cd2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
POLR2C Human Gene Knockout Kit (CRISPR)
KN401317 1 Kit

POLR2C Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mouse Cebpzos activation kit by CRISPRa
GA207855 1 Kit

Mouse Cebpzos activation kit by CRISPRa

Sign In for Pricing
View Details
Ethyl Paraben
TRC-E925475-5G 5 g

Ethyl Paraben

Sign In for Pricing
View Details
1-(2-Fluorobenzyl)-1H-pyrazolo[3,4-b]pyridine-3-carboximidamide Hydrochloride
TRC-F588235-500MG 500 mg

1-(2-Fluorobenzyl)-1H-pyrazolo[3,4-b]pyridine-3-carboximidamide Hydrochloride

Sign In for Pricing
View Details