Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Paracoccus denitrificans Heme exporter protein C (ccmC)

This Recombinant Paracoccus denitrificans Heme exporter protein C (ccmC) spans the amino acid sequence from region 1-241.

Product Specifications

Product Name Alternative

Heme exporter protein C, Cytochrome c-type biogenesis protein CcmC

UniProt

P52220

Expression Region

1-241

Origin

Paracoccus denitrificans (strain Pd 1222)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSIWEYANPVKFMRTSGAILPWVVAGAAACTVTGLVWGFLTPEDYKQGATVKIIFLHVPA ALMAINIWLMMLVTSLIWLIRRHHVSALAAKAAAPVGAVMTLIALITGAIWGQPMWGTWW EWDPRLTSFLILFLFYLGYMALWEAVENPDSAADLTGVLCLVGSVFALLSRYAVNFWNQG LHQGASLSMAPGERMAAVYRYPLYLTMAGFFLLFLALLLIRTRTEIRRRRLAALLARENR A

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Lung
CS508105 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
FITC–dextran conjugate (average MW = ~150K)
21704-AAT 25 mg

FITC–dextran conjugate (average MW = ~150K)

Sign In for Pricing
View Details
FAM71F2 (NM_001128926) Human Over-expression Lysate
LC427028 20 µg

FAM71F2 (NM_001128926) Human Over-expression Lysate

Sign In for Pricing
View Details
5- (AND-6) -CARBOXYTetramethylrhodamine SU
#90022 1x 25 mg

5- (AND-6) -CARBOXYTetramethylrhodamine SU

Sign In for Pricing
View Details
ACOT1 Rabbit Polyclonal Antibody
TA362154 100 µL

ACOT1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Glycophorin A / CD235a (Erythrocyte Marker) (GYPA/1725R), CF568 conjugate, 0.1mg/mL
BNC681725-100 1x 100 µL

Glycophorin A / CD235a (Erythrocyte Marker) (GYPA/1725R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details