Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Paracoccus denitrificans Heme exporter protein C (ccmC)

This Recombinant Paracoccus denitrificans Heme exporter protein C (ccmC) spans the amino acid sequence from region 1-241.

Product Specifications

Product Name Alternative

Heme exporter protein C, Cytochrome c-type biogenesis protein CcmC

UniProt

P52220

Expression Region

1-241

Origin

Paracoccus denitrificans (strain Pd 1222)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSIWEYANPVKFMRTSGAILPWVVAGAAACTVTGLVWGFLTPEDYKQGATVKIIFLHVPA ALMAINIWLMMLVTSLIWLIRRHHVSALAAKAAAPVGAVMTLIALITGAIWGQPMWGTWW EWDPRLTSFLILFLFYLGYMALWEAVENPDSAADLTGVLCLVGSVFALLSRYAVNFWNQG LHQGASLSMAPGERMAAVYRYPLYLTMAGFFLLFLALLLIRTRTEIRRRRLAALLARENR A

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cathepsin D (CTSD) Human Knockdown Lysate
LY300130 100 µg

Cathepsin D (CTSD) Human Knockdown Lysate

Sign In for Pricing
View Details
Mouse Tarbp2 activation kit by CRISPRa
GA204211 1 Kit

Mouse Tarbp2 activation kit by CRISPRa

Sign In for Pricing
View Details
Vmn1r60 Mouse Gene Knockout Kit (CRISPR)
KN519075 1 Kit

Vmn1r60 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Ksp-Cadherin / CDH16 (Renal Cell Marker) (CDH16/2125), CF594 conjugate, 0.1mg/mL
BNC942125-500 1x 500 µL

Ksp-Cadherin / CDH16 (Renal Cell Marker) (CDH16/2125), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Apoptosis enhancing nuclease (AEN) (NM_022767) Human Over-expression Lysate
LC402942 20 µg

Apoptosis enhancing nuclease (AEN) (NM_022767) Human Over-expression Lysate

Sign In for Pricing
View Details
Tocopherols (Technical Grade)
TRC-T730500-50G 50 g

Tocopherols (Technical Grade)

Sign In for Pricing
View Details