Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Protein mcbE (mcbE)

This Recombinant Protein mcbE (mcbE) spans the amino acid sequence from region 1-241.

Product Specifications

Product Name Alternative

Protein mcbE

UniProt

P05528

Expression Region

1-241

Origin

Escherichia coli

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVTLKMAIIFLMEQIRTPFSLIWTIMSPTVLFFFLHFNEIELHYGDTAWLGKQISWFVGY ISFSVVLFNYCLYLVGRRESGFIATFVHNMDGRLLFIRSQLIASLIMSILYVFFFILVVL TGFQASPDYQIVMIILKSIYINAFMMVSLTFMASFRVTFQTASTIYSVLITVCMVSGIVS LKYNEGIVYWINQVNPIAIYSTILQSDQELSLMTIFFYSIMLIISIISALTFKTEPVWSS Q

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TM2-115
BA2238-1 1 mg

TM2-115

Sign In for Pricing
View Details
Angiotensinogen (1-14), Porcine
orb2693571-01 5 mg

Angiotensinogen (1-14), Porcine

Sign In for Pricing
View Details
Angiotensinogen (1-14), Porcine
orb2693571-02 10 mg

Angiotensinogen (1-14), Porcine

Sign In for Pricing
View Details
Lentiviral human CCDC36 shRNA (UAS) - Lentiviral human CCDC36 shRNA (UAS) (100)
GTR15318333 1 Vial

Lentiviral human CCDC36 shRNA (UAS) - Lentiviral human CCDC36 shRNA (UAS) (100)

Sign In for Pricing
View Details
C1GALT1 (Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1, B3Gal-T8, Core 1 O-Glycan T-Synthase, Core 1 UDP-galactose:N-acetylgalactosamine-alpha-R beta 1,3-galactosyltransferase 1, Beta-1,3-galactosyltransferase, Core 1 beta1,3-galactosyltransferase 1, C1GalT1, Core 1 beta3-Gal-T1, C1GALT1) (MaxLight 550) discontinued
302307-ML550 100 µL

C1GALT1 (Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1, B3Gal-T8, Core 1 O-Glycan T-Synthase, Core 1 UDP-galactose:N-acetylgalactosamine-alpha-R beta 1,3-galactosyltransferase 1, Beta-1,3-galactosyltransferase, Core 1 beta1,3-galactosyltransferase 1, C1GalT1, Core 1 beta3-Gal-T1, C1GALT1) (MaxLight 550) discontinued

Sign In for Pricing
View Details
Charged slide, yellow frost
1358Y-72 72/Box

Charged slide, yellow frost

Sign In for Pricing
View Details