Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ1589 (MJ1589)

This Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ1589 (MJ1589) spans the amino acid sequence from region 1-241.

Product Specifications

Product Name Alternative

Uncharacterized protein MJ1589

UniProt

Q58984

Expression Region

1-241

Origin

Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMMALQIFIKILPIMFFGILLANLMCHLNILYKLQKYIKNKYFPIIAVFFVSSTSGSFLL KNLLKKGEISEENLLPIYFLGMFVFGIHIILFYAIPMATSLGWYVGGIYVLIKFLVTCNY LIISVLMLKKRKYNIDIEFKSKSEGLYGAIRDTFKQYFRVLTSFVPSVLIITYLIEHGLL DIVEDFAGSLLNALNLSPTILVIVLTGLATISGAIGIASGLLDENILSPNEVLFSLFLAG F

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(1S,2S)-1,2-Cyclopropanedicarboxylic Acid 1,2-Diethyl Ester
TRC-C990413-500MG 500 mg

(1S,2S)-1,2-Cyclopropanedicarboxylic Acid 1,2-Diethyl Ester

Sign In for Pricing
View Details
ARMH1 (NM_001145636) Human Recombinant Protein
TP327441L 1 mg

ARMH1 (NM_001145636) Human Recombinant Protein

Sign In for Pricing
View Details
LYK5 (STRADA) (NM_001003788) Human Over-expression Lysate
LY424003 100 µg

LYK5 (STRADA) (NM_001003788) Human Over-expression Lysate

Sign In for Pricing
View Details
CD14 (Monocyte / Macrophage Marker) (rLPSR/2408), CF647 conjugate, 0.1mg/mL
BNC473788-500 1x 500 µL

CD14 (Monocyte / Macrophage Marker) (rLPSR/2408), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ARID2 Rabbit Polyclonal Antibody
TA371215 100 µL

ARID2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ELP3 (NM_018091) Human Over-expression Lysate
LY402648 100 µg

ELP3 (NM_018091) Human Over-expression Lysate

Sign In for Pricing
View Details