Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ1589 (MJ1589)

This Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ1589 (MJ1589) spans the amino acid sequence from region 1-241.

Product Specifications

Product Name Alternative

Uncharacterized protein MJ1589

UniProt

Q58984

Expression Region

1-241

Origin

Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMMALQIFIKILPIMFFGILLANLMCHLNILYKLQKYIKNKYFPIIAVFFVSSTSGSFLL KNLLKKGEISEENLLPIYFLGMFVFGIHIILFYAIPMATSLGWYVGGIYVLIKFLVTCNY LIISVLMLKKRKYNIDIEFKSKSEGLYGAIRDTFKQYFRVLTSFVPSVLIITYLIEHGLL DIVEDFAGSLLNALNLSPTILVIVLTGLATISGAIGIASGLLDENILSPNEVLFSLFLAG F

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HLA class I histocompatibility antigen, A alpha chain (HLA-A) Antibody
abx233899 100 µg

HLA class I histocompatibility antigen, A alpha chain (HLA-A) Antibody

Sign In for Pricing
View Details
Ell2 Mouse qPCR Primer Pair (NM_138953)
MP204153 200 Reactions

Ell2 Mouse qPCR Primer Pair (NM_138953)

Sign In for Pricing
View Details
LRRC38 shRNA Plasmid (m)
sc-149076-SH 20 µg

LRRC38 shRNA Plasmid (m)

Sign In for Pricing
View Details
APC anti-human CD206
MBS9471313-01 25 Tests

APC anti-human CD206

Sign In for Pricing
View Details
APC anti-human CD206
MBS9471313-02 100 Tests

APC anti-human CD206

Sign In for Pricing
View Details
APC anti-human CD206
MBS9471313-03 5x 100 Tests

APC anti-human CD206

Sign In for Pricing
View Details