Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pseudomonas stutzeri Electron transport complex protein RnfE (rnfE)

This Recombinant Pseudomonas stutzeri Electron transport complex protein RnfE (rnfE) spans the amino acid sequence from region 1-241.

Product Specifications

Product Name Alternative

Electron transport complex protein RnfE, Nitrogen fixation protein RnfE

UniProt

Q9EVN2

Expression Region

1-241

Origin

Pseudomonas stutzeri (Pseudomonas perfectomarina)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSSQCGSADVTAPKPKGLFNYFSSALWDYNVALVQMLALCPALAVTTTATNGLGMGLATT LVLMITNAIISALRHSISPAVRNPLMIGIIAGVVTLIDMAINAWMHELYKVLGLFIALIV TNCAVLGRAESFCSRNPVLPSILDGRRAWASGFTWVLVVIGGIREILGQRARCSPRPRLL LGEHFRWLEITVLPGFQGILLAILPPGAFIVLGFVLAFKRVVDRRRAERRIRTHGELVVL Q

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Human CD23 (ABT294) Mouse Monoclonal Antibody
MBS9511114-01 0.05 mL

Anti-Human CD23 (ABT294) Mouse Monoclonal Antibody

Sign In for Pricing
View Details
Anti-Human CD23 (ABT294) Mouse Monoclonal Antibody
MBS9511114-02 0.1 mL

Anti-Human CD23 (ABT294) Mouse Monoclonal Antibody

Sign In for Pricing
View Details
Anti-Human CD23 (ABT294) Mouse Monoclonal Antibody
MBS9511114-03 0.2 mL

Anti-Human CD23 (ABT294) Mouse Monoclonal Antibody

Sign In for Pricing
View Details
Anti-Human CD23 (ABT294) Mouse Monoclonal Antibody
MBS9511114-04 1 mL

Anti-Human CD23 (ABT294) Mouse Monoclonal Antibody

Sign In for Pricing
View Details
Anti-Human CD23 (ABT294) Mouse Monoclonal Antibody
MBS9511114-05 5x 1 mL

Anti-Human CD23 (ABT294) Mouse Monoclonal Antibody

Sign In for Pricing
View Details
2-PMPA prodrug 1
HY-175863 1 Each

2-PMPA prodrug 1

Sign In for Pricing
View Details