Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Danio rerio Transmembrane protein 136 (tmem136)

This Recombinant Danio rerio Transmembrane protein 136 (tmem136) spans the amino acid sequence from region 1-242.

Product Specifications

Product Name Alternative

Transmembrane protein 136

UniProt

Q1LXV8

Expression Region

1-242

Origin

Danio rerio (Zebrafish) (Brachydanio rerio)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPLFIVETSCSLISWLFLYLLLCHLNSGRDSEWNCRLVTLFHGILIICLTAYIGFIAGPW PFTHPGTENTYFQILTLVLSLGYFLFDMAWCVYFRTEGPVMLAHHTMSIFGILLALGLGE SGIETCAVLFGSEITNPLLQARWFLKRMGCYDSLAGDVVDLLFILLFASVRIGVGSRMLY CELTSPKPSLIVKVGGVAIYTLSWIFMVDIARFACRKTCGKYRRWKEQYKLDGVNGHAVK IK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tyrosinase (T311), CF405S conjugate, 0.1mg/mL
BNC040012-500 1x 500 µL

Tyrosinase (T311), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IgA Secretory Component (SC05), CF568 conjugate, 0.1mg/mL
BNC680050-100 1x 100 µL

IgA Secretory Component (SC05), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (Pituitary Marker) (CLIP/2040R), CF647 conjugate, 0.1mg/mL
BNC472040-500 1x 500 µL

ACTH (Adrenocorticotrophic Hormone) (Pituitary Marker) (CLIP/2040R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TRAcP (Tartrate-Resistant Acid Phosphatase) (Hairy Cell Leukemia Marker) (ACP5/2336R), CF488A conjugate, 0.1mg/mL
BNC882336-500 1x 500 µL

TRAcP (Tartrate-Resistant Acid Phosphatase) (Hairy Cell Leukemia Marker) (ACP5/2336R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Catenin, beta (CTNNB1) (CTNNB1/2098), CF405S conjugate, 0.1mg/mL
BNC042098-500 1x 500 µL

Catenin, beta (CTNNB1) (CTNNB1/2098), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Plasma Cell Marker (LIV3G11, same as 7B18), CF568 conjugate, 0.1mg/mL
BNC680047-500 1x 500 µL

Plasma Cell Marker (LIV3G11, same as 7B18), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details