Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Cytochrome b ascorbate-dependent protein 3 (Cybasc3)

This Recombinant Mouse Cytochrome b ascorbate-dependent protein 3 (Cybasc3) spans the amino acid sequence from region 1-242.

Product Specifications

Product Name Alternative

Cytochrome b ascorbate-dependent protein 3, EC= 1.-.-.-, Lysosomal cytochrome b, LCytb

UniProt

Q6P1H1

Expression Region

1-242

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MASGWFYLSCMVLGSLGSMCILFTAYWMQYWRGGFAWDGTVLMFNWHPVLMVAGMVVLYG AASLVYRLPSSWVGPRLPWKVLHAALHLLAFTCTVVGLIAVFRFHNHSRIAHLYSLHSWL GITTVVLFACQWFLGFAVFLLPWASQWLRSLLKPLHVFFGACILSLSITSVISGINEKLF FVLKNATKPYSSLPGEAVFANSTGLLVVAFGLLVLYVLLASSWKRPDPGALTDRQPLLHD RE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fgf14 Mouse Monoclonal Antibody [Clone ID: N56/21]
75-096 100 µL

Fgf14 Mouse Monoclonal Antibody [Clone ID: N56/21]

Sign In for Pricing
View Details
Human CAMSAP1L1 (CAMSAP2) activation kit by CRISPRa
GA108180 1 Kit

Human CAMSAP1L1 (CAMSAP2) activation kit by CRISPRa

Sign In for Pricing
View Details
Recombinant RAP1GAP Antibody
RC-5288-01 50 μL

Recombinant RAP1GAP Antibody

Sign In for Pricing
View Details
Recombinant RAP1GAP Antibody
RC-5288-02 100 µL

Recombinant RAP1GAP Antibody

Sign In for Pricing
View Details
Recombinant RAP1GAP Antibody
RC-5288-03 1 mL

Recombinant RAP1GAP Antibody

Sign In for Pricing
View Details
Mouse Bche activation kit by CRISPRa
GA200377 1 Kit

Mouse Bche activation kit by CRISPRa

Sign In for Pricing
View Details