Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Cytochrome b ascorbate-dependent protein 3 (Cybasc3)

This Recombinant Mouse Cytochrome b ascorbate-dependent protein 3 (Cybasc3) spans the amino acid sequence from region 1-242.

Product Specifications

Product Name Alternative

Cytochrome b ascorbate-dependent protein 3, EC= 1.-.-.-, Lysosomal cytochrome b, LCytb

UniProt

Q6P1H1

Expression Region

1-242

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MASGWFYLSCMVLGSLGSMCILFTAYWMQYWRGGFAWDGTVLMFNWHPVLMVAGMVVLYG AASLVYRLPSSWVGPRLPWKVLHAALHLLAFTCTVVGLIAVFRFHNHSRIAHLYSLHSWL GITTVVLFACQWFLGFAVFLLPWASQWLRSLLKPLHVFFGACILSLSITSVISGINEKLF FVLKNATKPYSSLPGEAVFANSTGLLVVAFGLLVLYVLLASSWKRPDPGALTDRQPLLHD RE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

STAT2 (STAT2/2650), CF488A conjugate, 0.1mg/mL
BNC882650-100 1x 100 µL

STAT2 (STAT2/2650), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Thymidylate Synthase (TMS715), CF405S conjugate, 0.1mg/mL
BNC040715-500 1x 500 µL

Thymidylate Synthase (TMS715), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tyrosinase-Related Protein-1 (TYRP-1) (Melanoma Marker) (TYRP1/3280), Biotin conjugate, 0.1mg/mL
BNCB3280-500 1x 500 µL

Tyrosinase-Related Protein-1 (TYRP-1) (Melanoma Marker) (TYRP1/3280), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (AH26), CF405S conjugate, 0.1mg/mL
BNC040026-500 1x 500 µL

ACTH (Adrenocorticotrophic Hormone) (AH26), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
NUDT1 Mouse Monoclonal Antibody [Clone ID: AT3B3]
AM50635PU-N 100 µL

NUDT1 Mouse Monoclonal Antibody [Clone ID: AT3B3]

Sign In for Pricing
View Details
PDK4 (NM_002612) Human Over-expression Lysate
LC400924 20 µg

PDK4 (NM_002612) Human Over-expression Lysate

Sign In for Pricing
View Details