Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Cytochrome b ascorbate-dependent protein 3 (CYBASC3)

This Recombinant Human Cytochrome b ascorbate-dependent protein 3 (CYBASC3) spans the amino acid sequence from region 1-242.

Product Specifications

Product Name Alternative

Cytochrome b ascorbate-dependent protein 3, EC= 1.-.-.-, Lysosomal cytochrome b, LCytb

UniProt

Q8NBI2

Expression Region

1-242

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVSGRFYLSCLLLGSLGSMCILFTIYWMQYWRGGFAWNGSIYMFNWHPVLMVAGMVVFYG GASLVYRLPQSWVGPKLPWKLLHAALHLMAFVLTVVGLVAVFTFHNHGRTANLYSLHSWL GITTVFLFACQWFLGFAVFLLPWASMWLRSLLKPIHVFFGAAILSLSIASVISGINEKLF FSLKNTTRPYHSLPSEAVFANSTGMLVVAFGLLVLYILLASSWKRPEPGILTDRQPLLHD GE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Rickettsia conorii Phospho-N-acetylmuramoyl-pentapeptide-transferase (mraY), partial
MBS7097449 Inquire

Recombinant Rickettsia conorii Phospho-N-acetylmuramoyl-pentapeptide-transferase (mraY), partial

Sign In for Pricing
View Details
Rabbit anti-Synechococcus elongatus (strain PCC 7942)(Anacystis nidulans R2) RECF Polyclonal Antibody
MBS7193505 Inquire

Rabbit anti-Synechococcus elongatus (strain PCC 7942)(Anacystis nidulans R2) RECF Polyclonal Antibody

Sign In for Pricing
View Details
CD36 (NM_001289911) Human Tagged ORF Clone
RC237956 10 µg

CD36 (NM_001289911) Human Tagged ORF Clone

Sign In for Pricing
View Details
Epithelial Cell Medium
ABC-TM010 1 Kit

Epithelial Cell Medium

Sign In for Pricing
View Details
Rabbit Polyclonal L3MBTL2 Antibody
NBP1-49964 0.1 mL

Rabbit Polyclonal L3MBTL2 Antibody

Sign In for Pricing
View Details
(2R) -3-Amino-1,1,1-trifluoropropan-2-ol hydrochloride
FCC71258-01 50 mg

(2R) -3-Amino-1,1,1-trifluoropropan-2-ol hydrochloride

Sign In for Pricing
View Details