Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Cytochrome b ascorbate-dependent protein 3 (CYBASC3)

This Recombinant Human Cytochrome b ascorbate-dependent protein 3 (CYBASC3) spans the amino acid sequence from region 1-242.

Product Specifications

Product Name Alternative

Cytochrome b ascorbate-dependent protein 3, EC= 1.-.-.-, Lysosomal cytochrome b, LCytb

UniProt

Q8NBI2

Expression Region

1-242

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVSGRFYLSCLLLGSLGSMCILFTIYWMQYWRGGFAWNGSIYMFNWHPVLMVAGMVVFYG GASLVYRLPQSWVGPKLPWKLLHAALHLMAFVLTVVGLVAVFTFHNHGRTANLYSLHSWL GITTVFLFACQWFLGFAVFLLPWASMWLRSLLKPIHVFFGAAILSLSIASVISGINEKLF FSLKNTTRPYHSLPSEAVFANSTGMLVVAFGLLVLYILLASSWKRPEPGILTDRQPLLHD GE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GITR / TNFRSF18 Protein (mFc Tag)
M60-175-L1000 1000 µg

GITR / TNFRSF18 Protein (mFc Tag)

Sign In for Pricing
View Details
Mouse L-Selectin/CD62L ELISA Kit
NR-E10608-01 96 Tests

Mouse L-Selectin/CD62L ELISA Kit

Sign In for Pricing
View Details
Mouse L-Selectin/CD62L ELISA Kit
NR-E10608-02 2x 96 Tests

Mouse L-Selectin/CD62L ELISA Kit

Sign In for Pricing
View Details
Mouse L-Selectin/CD62L ELISA Kit
NR-E10608-03 4x 96 Tests

Mouse L-Selectin/CD62L ELISA Kit

Sign In for Pricing
View Details
Purified anti-mouse CD183 (CXCR3)
E16FMU183-200U 200 µg

Purified anti-mouse CD183 (CXCR3)

Sign In for Pricing
View Details
SLC19A2 (NM_006996) Human Over-expression Lysate
E45H08453-2 20 µg

SLC19A2 (NM_006996) Human Over-expression Lysate

Sign In for Pricing
View Details