Recombinant Rickettsia canadensis ATP synthase subunit a (atpB)
This Recombinant Rickettsia canadensis ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-242.
Product Specifications
Product Name Alternative
ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6
UniProt
A8EX90
Expression Region
1-242
Origin
Rickettsia canadensis (strain McKiel)
Field of Research
Immunology & Inflammation; Metabolism Research
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MTLNPLVQFDIKKLIEIKIFGFDISFTNSSIYMLLASILALTYFYLAFYNWKLVPSRLQV SAEIVYNLVADMLNQNIGAKGHKFIPLFFSLFIFILFCNLLGMTPYSFTVTSHIIVTFAL AILVFLTITIVGFVKHSLRFLTLFLPHGTPLWLAPLMIVIELFTYLARPISLSLRLAANM MAGHVLLKVIASFTISLMIYLKFISIPLMVILIGFEIFIAVLQAYIFTILSCMYLNDAIN LH
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC682889-100 1x 100 µL
Secretory Component / ECM1 (ECM1/2889R), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC741766-100 1x 100 µL
CD43 (T-Cell Marker) (SPN/1766R), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC042059-100 1x 100 µL
TNFS15 / VEGI (Vascular Endothelial Growth Inhibitor) (rVEGI/1283), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC681373-100 1x 100 µL
Ep-CAM / CD326 (Extracellular Domain) (Epithelial Marker) (EGP40/1373), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details