Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rickettsia bellii ATP synthase subunit a (atpB)

This Recombinant Rickettsia bellii ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-242.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

A8GUJ3

Expression Region

1-242

Origin

Rickettsia bellii (strain OSU 85-389)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLHNPLVQFDIKKLIDIKVMDFDISFTNSAAYMLLASVLALTYFYLAFSNPRLVPSRLQI SGEIIYNLVTDMLNQNVGSKGRKFVPVIFTLFVFILFCNLFGMIPYGFTVTSHIIITFAL AILVFLMVTIVGFVKHGMHFLSLFLPHGTPLWLAPLMIIIELFTYLARPASLSLRLAANM MAGHILLKVIASFVITLMIYLKFLPIPLMVILIGFEIFVAILQAYIFTILSCVYLNDAVN LH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF647 conjugate, 0.1mg/mL
BNC471820-100 1x 100 µL

Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45 / LCA (2B11 + PD7/26), CF740 conjugate, 0.1mg/mL
BNC740745-500 1x 500 µL

CD45 / LCA (2B11 + PD7/26), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Caldesmon, HMW (h-Caldesmon) (CALD1/820), CF647 conjugate, 0.1mg/mL
BNC470820-500 1x 500 µL

Caldesmon, HMW (h-Caldesmon) (CALD1/820), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TLE1 (Synovial Sarcoma Marker) (TLE1/2946R), CF568 conjugate, 0.1mg/mL
BNC682946-100 1x 100 µL

TLE1 (Synovial Sarcoma Marker) (TLE1/2946R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human Kappa Light Chain (L1C1), CF568 conjugate, 0.1mg/mL
BNC680018-500 1x 500 µL

Human Kappa Light Chain (L1C1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD7 (T3-3A1), CF594 conjugate, 0.1mg/mL
BNC940978-500 1x 500 µL

CD7 (T3-3A1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details