Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rhodobacter capsulatus Heme exporter protein C (helC)

This Recombinant Rhodobacter capsulatus Heme exporter protein C (helC) spans the amino acid sequence from region 1-242.

Product Specifications

Product Name Alternative

Heme exporter protein C, Cytochrome c-type biogenesis protein HelC

UniProt

P29961

Expression Region

1-242

Origin

Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSIWEYANPVKFMQTSGRLLPWVVAATVLTLLPGLVWGFFFTPVAAEFGATVKVIYVHVP AATLAINIWVMMLVASLIWLIRRHHVSALAAKAAAPIGMVMTLIALITGAFWGQPMWGTW WEWDPRLTSFLILFLFYLGYMALWEAIENPDTAADLTGVLCLVGSVFAVLSRYAAIFWNQ GLHQGSTLSLDKEEHIADVYWQPLVLSIAGFGMLFVALLLLRTRTEIRARRLKALEQRER MA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD11c (HC1/1), CF640R conjugate, 0.1mg/mL
BNC400152-500 1x 500 µL

CD11c (HC1/1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MART-1 / Melan-A (M2-7C10), CF594 conjugate, 0.1mg/mL
BNC940009-100 1x 100 µL

MART-1 / Melan-A (M2-7C10), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Major Vault Protein (MVP) (1014), CF405S conjugate, 0.1mg/mL
BNC040224-500 1x 500 µL

Major Vault Protein (MVP) (1014), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MHC II (HLA-DP) (beta chain) (Bra-14), CF594 conjugate, 0.1mg/mL
BNC941129-100 1x 100 µL

MHC II (HLA-DP) (beta chain) (Bra-14), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Bcl-2 (100/D5), CF740 conjugate, 0.1mg/mL
BNC740045-500 1x 500 µL

Bcl-2 (100/D5), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD68 (KP1), CF405M conjugate, 0.1mg/mL
BNC050512-100 1x 100 µL

CD68 (KP1), CF405M conjugate, 0.1mg/mL

Sign In for Pricing
View Details