Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mycobacterium vanbaalenii Cobalamin synthase (cobS)

This Recombinant Mycobacterium vanbaalenii Cobalamin synthase (cobS) spans the amino acid sequence from region 1-243.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

A1TB16

Expression Region

1-243

Origin

Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MISSLTGAFAFATVLPTPTRATAMVGRGVLTALPVAGAALGVLAAGVLWAGSWAFGDGSA LAGVLTVAVLLLATRGLHIDGLSDTVDALGCYGPPERALAVMRDGTAGPFGVAAVAATLL VQSLAFAQSGWAAVFIAVVAGRVAVVAACRRGVPAAAGSTLGALVSGTQPRWVAAGWTVA VAAAAVPVCARPWQGPLVVALALACSAGLVAHCVRRFGGITGDVLGAALEVTTTIAAVGL AVR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Ahcy ELISA Kit
ELI-04171r 96 Tests

Rat Ahcy ELISA Kit

Sign In for Pricing
View Details
MMP-1 Rabbit Polyclonal Antibody (BF405)
orb2416344 100 µL

MMP-1 Rabbit Polyclonal Antibody (BF405)

Sign In for Pricing
View Details
LARS2 antibody
OAGA00825-100UL 100 µL

LARS2 antibody

Sign In for Pricing
View Details
Flt-3/Flk-2 (SF1.340) Alexa Fluor® 647
sc-19635 AF647 200 µg/mL

Flt-3/Flk-2 (SF1.340) Alexa Fluor® 647

Sign In for Pricing
View Details
HOXA7 Protein Vector (Mouse) (pPM-C-HA)
23809024 500 ng

HOXA7 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
FAM83E Polyclonal Antibody, PerCP-Cy5.5 Conjugated
bs-16016R-PerCP-Cy5.5 100 µL

FAM83E Polyclonal Antibody, PerCP-Cy5.5 Conjugated

Sign In for Pricing
View Details