Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mycobacterium gilvum Cobalamin synthase (cobS)

This Recombinant Mycobacterium gilvum Cobalamin synthase (cobS) spans the amino acid sequence from region 1-243.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

A4TBJ8

Expression Region

1-243

Origin

Mycobacterium gilvum (strain PYR-GCK) (Mycobacterium flavescens (strain ATCC 700033 / PYR-GCK) )

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTRSLAGAFAFATVMPVPSRRAAIAGRGVLTALPVVGLVLGSAAAAVCWLGTRAFGSGSV LAGALTVAVLLLATRGLHIDGLSDTTDALGCYGPAERALAVMRDGRAGPFGVAAVAVTVV IQSVAFSQAGWAAVLVAVAAGRVAVVVACRRGVPAAEGSTLGALVAGTQPLWVAAAWLVA IAGLATLAGERAWQGPLAVVVAVACSVVMVAHCVRRFGGITGDVLGAAVEVTTTVTALGL AIA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Colloidal Gold Conjugated Sheep Affinity Purified Antibody to Mouse IgG1,  5nm
GM-300-5 1 mL

Colloidal Gold Conjugated Sheep Affinity Purified Antibody to Mouse IgG1, 5nm

Sign In for Pricing
View Details
CaMKK (CAMKK1) Rabbit Polyclonal Antibody
AP14557PU-N 400 µL

CaMKK (CAMKK1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Apolipoprotein L 1 (APOL1) Mouse Monoclonal Antibody [Clone ID: OTI5H4]
CF812044 100 µg

Apolipoprotein L 1 (APOL1) Mouse Monoclonal Antibody [Clone ID: OTI5H4]

Sign In for Pricing
View Details
GNAT2 Polyclonal Antibody
E-AB-90138-01 60 µL

GNAT2 Polyclonal Antibody

Sign In for Pricing
View Details
GNAT2 Polyclonal Antibody
E-AB-90138-02 120 µL

GNAT2 Polyclonal Antibody

Sign In for Pricing
View Details
GNAT2 Polyclonal Antibody
E-AB-90138-03 200 µL

GNAT2 Polyclonal Antibody

Sign In for Pricing
View Details