Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mycobacterium gilvum Cobalamin synthase (cobS)

This Recombinant Mycobacterium gilvum Cobalamin synthase (cobS) spans the amino acid sequence from region 1-243.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

A4TBJ8

Expression Region

1-243

Origin

Mycobacterium gilvum (strain PYR-GCK) (Mycobacterium flavescens (strain ATCC 700033 / PYR-GCK) )

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTRSLAGAFAFATVMPVPSRRAAIAGRGVLTALPVVGLVLGSAAAAVCWLGTRAFGSGSV LAGALTVAVLLLATRGLHIDGLSDTTDALGCYGPAERALAVMRDGRAGPFGVAAVAVTVV IQSVAFSQAGWAAVLVAVAAGRVAVVVACRRGVPAAEGSTLGALVAGTQPLWVAAAWLVA IAGLATLAGERAWQGPLAVVVAVACSVVMVAHCVRRFGGITGDVLGAAVEVTTTVTALGL AIA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

StomL2 Mouse Gene Knockout Kit (CRISPR)
KN516896 1 Kit

StomL2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mouse Ch25h activation kit by CRISPRa
GA200709 1 Kit

Mouse Ch25h activation kit by CRISPRa

Sign In for Pricing
View Details
Human RESP18 activation kit by CRISPRa
GA118019 1 Kit

Human RESP18 activation kit by CRISPRa

Sign In for Pricing
View Details
DUX4L4 Human Gene Knockout Kit (CRISPR)
KN430158 1 Kit

DUX4L4 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
P2Y9 (LPAR4) (NM_005296) Human Over-expression Lysate
LY401630 100 µg

P2Y9 (LPAR4) (NM_005296) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Human CT1 Protein (Trx Tag)
PDEH100518-01 20 µg

Recombinant Human CT1 Protein (Trx Tag)

Sign In for Pricing
View Details