Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mycobacterium gilvum Cobalamin synthase (cobS)

This Recombinant Mycobacterium gilvum Cobalamin synthase (cobS) spans the amino acid sequence from region 1-243.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

A4TBJ8

Expression Region

1-243

Origin

Mycobacterium gilvum (strain PYR-GCK) (Mycobacterium flavescens (strain ATCC 700033 / PYR-GCK) )

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTRSLAGAFAFATVMPVPSRRAAIAGRGVLTALPVVGLVLGSAAAAVCWLGTRAFGSGSV LAGALTVAVLLLATRGLHIDGLSDTTDALGCYGPAERALAVMRDGRAGPFGVAAVAVTVV IQSVAFSQAGWAAVLVAVAAGRVAVVVACRRGVPAAEGSTLGALVAGTQPLWVAAAWLVA IAGLATLAGERAWQGPLAVVVAVACSVVMVAHCVRRFGGITGDVLGAAVEVTTTVTALGL AIA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Demecolcine
TRC-D230785-1MG 1 mg

Demecolcine

Sign In for Pricing
View Details
Potassium Chromate
TRC-P695105-5G 5 g

Potassium Chromate

Sign In for Pricing
View Details
DNAJC22 (C-term) Rabbit Polyclonal Antibody
AP51293PU-N 400 µL

DNAJC22 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Jacalin Coated - 96 well Solid plates - Clear PS
MC10F-JAC 10x 96 Well Plates

Jacalin Coated - 96 well Solid plates - Clear PS

Sign In for Pricing
View Details
Mix-n-StainTM CF®594 Nanobody Labeling Kit, 1x (5-20ug) labeling
#92508 1 Kit

Mix-n-StainTM CF®594 Nanobody Labeling Kit, 1x (5-20ug) labeling

Sign In for Pricing
View Details
Mouse Cfl2 activation kit by CRISPRa
GA200706 1 Kit

Mouse Cfl2 activation kit by CRISPRa

Sign In for Pricing
View Details