Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Putative membrane peptidase ydiL (ydiL)

This Recombinant Bacillus subtilis Putative membrane peptidase ydiL (ydiL) spans the amino acid sequence from region 1-244.

Product Specifications

Product Name Alternative

Putative membrane peptidase ydiL, EC= 3.4.-.-

UniProt

O05525

Expression Region

1-244

Origin

Bacillus subtilis (strain 168)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRKQYWFIILTYIIMQFSALIAIPLLFKFGYAGGQPTDENMLHAQGLWSVISFIACLVVV LLILRTVPKETLRNGQKDSIGLSILWAIAGFFIALFSQGIAGSIEYYVFGIGRESENTQA ILDVIQAVPLMIIVSSIVGPILEEIIFRKIIFGALYEKTNFFFAGLISSVIFGIVHADLK HLLLYTAMGFTFAFLYARTKRIWVPIFAHLMMNTFVVIMQLEPVRNYLEQQSTQMQLIIG GLFL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Meig1 Mouse Gene Knockout Kit (CRISPR)
KN509963 1 Kit

Meig1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Anti-GSTP1 Antibody (3O380)
TMAB-06833-01 25 µL

Anti-GSTP1 Antibody (3O380)

Sign In for Pricing
View Details
Anti-GSTP1 Antibody (3O380)
TMAB-06833-02 50 μL

Anti-GSTP1 Antibody (3O380)

Sign In for Pricing
View Details
Anti-GSTP1 Antibody (3O380)
TMAB-06833-03 100 µL

Anti-GSTP1 Antibody (3O380)

Sign In for Pricing
View Details
Rabbit Polyclonal CCDC90B Antibody [DyLight 594]
NBP3-05879DL594 0.1 mL

Rabbit Polyclonal CCDC90B Antibody [DyLight 594]

Sign In for Pricing
View Details
Human Phosphorylation Mixed Lineage Kinase Domain Like Protein ELISA Kit
MBS3804692-01 48 Well

Human Phosphorylation Mixed Lineage Kinase Domain Like Protein ELISA Kit

Sign In for Pricing
View Details