Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_2132 (AF_2132)

This Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_2132 (AF_2132) spans the amino acid sequence from region 1-244.

Product Specifications

Product Name Alternative

Uncharacterized protein AF_2132

UniProt

O28148

Expression Region

1-244

Origin

Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNKGKFALLFTFAACFAVIVFFWLLAVPPENFTADRIVMVLLISPIFAILLAFNLSRFLK QHGYSLRQVHVALEQNIADFIYEFQRLVFIHLMPIAFLGALIFYYGEFTPAIAEFLSLFA LIFALSPLLFLGISFFVAMLQVYERVRKKSLLRANFFNFWIWIHLFVILLIIISKVLVQP SELPFQKAYFKALNDGVFNLLIIATMNAIFGVTGRMVAREKFPILLHLSIPLVNSFVAVK ILMA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant human PRL protein, N-His (HEK293)
orb1516608-01 20 µg

Recombinant human PRL protein, N-His (HEK293)

Sign In for Pricing
View Details
Recombinant human PRL protein, N-His (HEK293)
orb1516608-02 100 µg

Recombinant human PRL protein, N-His (HEK293)

Sign In for Pricing
View Details
Recombinant human PRL protein, N-His (HEK293)
orb1516608-03 500 µg

Recombinant human PRL protein, N-His (HEK293)

Sign In for Pricing
View Details
HIST1H4A Antibody
orb516358-01 50 μL

HIST1H4A Antibody

Sign In for Pricing
View Details
HIST1H4A Antibody
orb516358-02 100 µL

HIST1H4A Antibody

Sign In for Pricing
View Details
Rabbit Monoclonal MGMT Antibody (MGMT/8186R) [Janelia Fluor 669]
NBP3-21106JF669 0.1 mL

Rabbit Monoclonal MGMT Antibody (MGMT/8186R) [Janelia Fluor 669]

Sign In for Pricing
View Details