Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_2132 (AF_2132)

This Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_2132 (AF_2132) spans the amino acid sequence from region 1-244.

Product Specifications

Product Name Alternative

Uncharacterized protein AF_2132

UniProt

O28148

Expression Region

1-244

Origin

Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNKGKFALLFTFAACFAVIVFFWLLAVPPENFTADRIVMVLLISPIFAILLAFNLSRFLK QHGYSLRQVHVALEQNIADFIYEFQRLVFIHLMPIAFLGALIFYYGEFTPAIAEFLSLFA LIFALSPLLFLGISFFVAMLQVYERVRKKSLLRANFFNFWIWIHLFVILLIIISKVLVQP SELPFQKAYFKALNDGVFNLLIIATMNAIFGVTGRMVAREKFPILLHLSIPLVNSFVAVK ILMA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Biotinylated Human LILRA5 (C-6His-Avi)
32-11445-20 20 µg

Biotinylated Human LILRA5 (C-6His-Avi)

Sign In for Pricing
View Details
D10Wsu102e sgRNA CRISPR Lentivector set (Mouse)
K3502701 3x 1.0 µg

D10Wsu102e sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
PHD2 Rabbit Polyclonal Antibody (RBITC)
orb1047022 100 µL

PHD2 Rabbit Polyclonal Antibody (RBITC)

Sign In for Pricing
View Details
CLCA4 cDNA Clone
MBS1273841-01 0.01 mg Plasmid + 0.2 mL Glycerol-Stock

CLCA4 cDNA Clone

Sign In for Pricing
View Details
CLCA4 cDNA Clone
MBS1273841-02 5x 0.01 mg Plasmid + 5x 0.2 mL Glycerol-Stock

CLCA4 cDNA Clone

Sign In for Pricing
View Details
PRODH siRNA (Human)
CRH3791-01 15 nmol

PRODH siRNA (Human)

Sign In for Pricing
View Details