Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_2132 (AF_2132)

This Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_2132 (AF_2132) spans the amino acid sequence from region 1-244.

Product Specifications

Product Name Alternative

Uncharacterized protein AF_2132

UniProt

O28148

Expression Region

1-244

Origin

Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNKGKFALLFTFAACFAVIVFFWLLAVPPENFTADRIVMVLLISPIFAILLAFNLSRFLK QHGYSLRQVHVALEQNIADFIYEFQRLVFIHLMPIAFLGALIFYYGEFTPAIAEFLSLFA LIFALSPLLFLGISFFVAMLQVYERVRKKSLLRANFFNFWIWIHLFVILLIIISKVLVQP SELPFQKAYFKALNDGVFNLLIIATMNAIFGVTGRMVAREKFPILLHLSIPLVNSFVAVK ILMA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PARP11 antibody
70R-1285 100 µL

PARP11 antibody

Sign In for Pricing
View Details
VGF (B-6)
sc-515482 200 µg/mL

VGF (B-6)

Sign In for Pricing
View Details
Mouse Monoclonal SBSN Antibody (SBSN/7964)
NBP3-20568-100ug 100 µg

Mouse Monoclonal SBSN Antibody (SBSN/7964)

Sign In for Pricing
View Details
CD18 (ITGB2) (NM_001303238) Human Tagged ORF Clone
RG239346 10 µg

CD18 (ITGB2) (NM_001303238) Human Tagged ORF Clone

Sign In for Pricing
View Details
MPL Antibody
MBS9435315-01 0.05 mL

MPL Antibody

Sign In for Pricing
View Details
MPL Antibody
MBS9435315-02 0.1 mL

MPL Antibody

Sign In for Pricing
View Details