Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus amyloliquefaciens ATP synthase subunit a (atpB)

This Recombinant Bacillus amyloliquefaciens ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-244.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

A7Z9Q6

Expression Region

1-244

Origin

Bacillus amyloliquefaciens (strain FZB42)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNHDYRTIDLFGLTFNLTNILMITVASVIVLLIAILTTRTLSIRPGKAQNFMEWIVDFVR NIIGSTMDLKTGANFLALGVTLLMYIFVSNMLGLPFSVTVGHELWWKSPTADPAITLTLA VMVVSLTHYYGVKMKGLKEYSKDYLRPVPLMFPMKIIEEFANTLTLGLRLYGNIFAGEIL LGLLANLATNFYSNSFFLGLVGTVGAIIPMLAWQAFSLFIGTIQAFIFTMLTMVYMSHKI SHDH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD50 (ICAM-3) (101-1D2), CF740 conjugate, 0.1mg/mL
BNC740177-100 1x 100 µL

CD50 (ICAM-3) (101-1D2), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Eosinophil Peroxidase (AHE-1), CF740 conjugate, 0.1mg/mL
BNC741231-100 1x 100 µL

Eosinophil Peroxidase (AHE-1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF488A conjugate, 0.1mg/mL
BNC880630-100 1x 100 µL

Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (HFN7.1), CF568 conjugate, 0.1mg/mL
BNC680270-500 1x 500 µL

Fibronectin (HFN7.1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 5AC (MUC5AC) (45M1), CF640R conjugate, 0.1mg/mL
BNC400031-500 1x 500 µL

Mucin 5AC (MUC5AC) (45M1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Carcinoembryonic Antigen (CEA) / CD66 (C66/1983R), CF594 conjugate, 0.1mg/mL
BNC941983-500 1x 500 µL

Carcinoembryonic Antigen (CEA) / CD66 (C66/1983R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details