Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Marchantia polymorpha Uncharacterized tatC-like protein ymf16 (YMF16)

This Recombinant Marchantia polymorpha Uncharacterized tatC-like protein ymf16 (YMF16) spans the amino acid sequence from region 1-244.

Product Specifications

Product Name Alternative

Uncharacterized tatC-like protein ymf16, ORF 244

UniProt

P38459

Expression Region

1-244

Origin

Marchantia polymorpha (Liverwort) (Marchantia aquatica)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNFVLKTILEEVRIRVFWILICFSFTWFTCYWFSEEFIFLLAKPFLTLPYLDSSFICTQL TEALSTYVTTSLISCFYFLFPFLSYQIWCFLMPSCYEEQRKKYNKLFYLSGFCFFLFFFV TFVWIVPNVWHFLYKLSTTSTNLLIIKLQPKIFDYIMLTVRILFISSICSQVPVLVICLL ESKGVKTFIKNRRFFYSFFAFHSSFFYTPDIWCQIIACLPIYFIIELTIFYALIIQVYKK QLAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OLIG2 (Marker of Glial Brain Tumors) (OLIG2/2400), Biotin conjugate, 0.1mg/mL
BNCB2400-100 1x 100 µL

OLIG2 (Marker of Glial Brain Tumors) (OLIG2/2400), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue Total RNA, Colon: left
CR562940 5 µg

Tissue Total RNA, Colon: left

Sign In for Pricing
View Details
Tau (T217) Antibody
KC-45013-01 50 μL

Tau (T217) Antibody

Sign In for Pricing
View Details
Tau (T217) Antibody
KC-45013-02 100 µL

Tau (T217) Antibody

Sign In for Pricing
View Details
Tau (T217) Antibody
KC-45013-03 1 mL

Tau (T217) Antibody

Sign In for Pricing
View Details
ERG (NM_004449) Human Over-expression Lysate
LY401413 100 µg

ERG (NM_004449) Human Over-expression Lysate

Sign In for Pricing
View Details