Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Marchantia polymorpha Uncharacterized tatC-like protein ymf16 (YMF16)

This Recombinant Marchantia polymorpha Uncharacterized tatC-like protein ymf16 (YMF16) spans the amino acid sequence from region 1-244.

Product Specifications

Product Name Alternative

Uncharacterized tatC-like protein ymf16, ORF 244

UniProt

P38459

Expression Region

1-244

Origin

Marchantia polymorpha (Liverwort) (Marchantia aquatica)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNFVLKTILEEVRIRVFWILICFSFTWFTCYWFSEEFIFLLAKPFLTLPYLDSSFICTQL TEALSTYVTTSLISCFYFLFPFLSYQIWCFLMPSCYEEQRKKYNKLFYLSGFCFFLFFFV TFVWIVPNVWHFLYKLSTTSTNLLIIKLQPKIFDYIMLTVRILFISSICSQVPVLVICLL ESKGVKTFIKNRRFFYSFFAFHSSFFYTPDIWCQIIACLPIYFIIELTIFYALIIQVYKK QLAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vmn1r13 Mouse Gene Knockout Kit (CRISPR)
KN518932 1 Kit

Vmn1r13 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
FBXW9 (NM_032301) Human Recombinant Protein
TP315951 20 µg

FBXW9 (NM_032301) Human Recombinant Protein

Sign In for Pricing
View Details
TIM 3 (HAVCR2) Human Gene Knockout Kit (CRISPR)
KN209440LP 1 Kit

TIM 3 (HAVCR2) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ATP1B4 Antibody (Biotin)
KB-37277-01 50 μL

ATP1B4 Antibody (Biotin)

Sign In for Pricing
View Details
ATP1B4 Antibody (Biotin)
KB-37277-02 100 µL

ATP1B4 Antibody (Biotin)

Sign In for Pricing
View Details
ATP1B4 Antibody (Biotin)
KB-37277-03 1 mL

ATP1B4 Antibody (Biotin)

Sign In for Pricing
View Details