Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Marchantia polymorpha Uncharacterized tatC-like protein ymf16 (YMF16)

This Recombinant Marchantia polymorpha Uncharacterized tatC-like protein ymf16 (YMF16) spans the amino acid sequence from region 1-244.

Product Specifications

Product Name Alternative

Uncharacterized tatC-like protein ymf16, ORF 244

UniProt

P38459

Expression Region

1-244

Origin

Marchantia polymorpha (Liverwort) (Marchantia aquatica)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNFVLKTILEEVRIRVFWILICFSFTWFTCYWFSEEFIFLLAKPFLTLPYLDSSFICTQL TEALSTYVTTSLISCFYFLFPFLSYQIWCFLMPSCYEEQRKKYNKLFYLSGFCFFLFFFV TFVWIVPNVWHFLYKLSTTSTNLLIIKLQPKIFDYIMLTVRILFISSICSQVPVLVICLL ESKGVKTFIKNRRFFYSFFAFHSSFFYTPDIWCQIIACLPIYFIIELTIFYALIIQVYKK QLAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACTH (Adrenocorticotrophic Hormone) (AH26), 1mg/mL
BNUM0026-50 1x 50 µL

ACTH (Adrenocorticotrophic Hormone) (AH26), 1mg/mL

Sign In for Pricing
View Details
N-(2-Succinyl) Phenylephrine 2,3'-O-Dibenzyl Ether 1,4-Dibenzyl Ester
TRC-S688860-25MG 25 mg

N-(2-Succinyl) Phenylephrine 2,3'-O-Dibenzyl Ether 1,4-Dibenzyl Ester

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS703026 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
FastClick™ Biotin Azide
72801-AAT 1 mg

FastClick™ Biotin Azide

Sign In for Pricing
View Details
Frozen Tissue Blocks, Breast
CB623238 1 Block

Frozen Tissue Blocks, Breast

Sign In for Pricing
View Details
BMP6 Mouse Monoclonal Antibody [Clone ID: OTI4A3]
CF812214 100 µg

BMP6 Mouse Monoclonal Antibody [Clone ID: OTI4A3]

Sign In for Pricing
View Details